PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN05063.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 272aa    MW: 31152 Da    PI: 5.9869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN05063.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W teEd++l  +++++G g+W++ ++  g+ R++k+c++rw +yl
       KHN05063.1 14 KGPWATEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding513.4e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w++ 
       KHN05063.1  67 RGNFTIEEEETIIKLHEMLGNR-WSAIAAKLP-GRTDNEIKNVWHTN 111
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.229961IPR017930Myb domain
SuperFamilySSF466891.91E-3010108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-141461IPR001005SANT/Myb domain
CDDcd001673.82E-91661No hitNo description
PROSITE profilePS5129424.80162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2565116IPR009057Homeodomain-like
SMARTSM007173.6E-1366114IPR001005SANT/Myb domain
PfamPF002499.1E-1567111IPR001005SANT/Myb domain
CDDcd001671.51E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWATE EDQILTSYIQ KHGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TIEEEETIIK LHEMLGNRWS AIAAKLPGRT DNEIKNVWHT NLKKRLLKSD  120
QSKPSSKRAT KPKIKRSDSN SSIITQSEPA HLRFREMDTT STACNTSSSD FSSVTVGDSK  180
NIIKSEDIES METMPVIDES FWSEAAIDDE TPTMSSQSLI TISNDMPLQY PFANYEETFQ  240
QSHAYDSNFD DGMDFWYDIF TRTNDSIELS EF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0291650.0AB029165.1 Glycine max GmMYB29B2 gene, complete cds.
GenBankBT0971170.0BT097117.1 Soybean clone JCVI-FLGm-21J11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241018.10.0uncharacterized protein LOC100807569
TrEMBLA0A0B2PBJ70.0A0A0B2PBJ7_GLYSO; Myb-related protein Myb4
TrEMBLQ9XIU50.0Q9XIU5_SOYBN; GmMYB29B2 protein
STRINGGLYMA20G35180.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-85myb domain protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]